Protein Info for Shewana3_3206 in Shewanella sp. ANA-3

Annotation: organic solvent tolerance protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 765 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF03968: LptD_N" amino acids 54 to 185 (132 residues), 46.3 bits, see alignment E=4.7e-16 PF04453: LptD" amino acids 294 to 666 (373 residues), 415.8 bits, see alignment E=2.2e-128

Best Hits

Swiss-Prot: 100% identical to LPTD_SHESA: LPS-assembly protein LptD (lptD) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K04744, LPS-assembly protein (inferred from 100% identity to shn:Shewana3_3206)

Predicted SEED Role

"Outer membrane protein Imp, required for envelope biogenesis / Organic solvent tolerance protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L061 at UniProt or InterPro

Protein Sequence (765 amino acids)

>Shewana3_3206 organic solvent tolerance protein (RefSeq) (Shewanella sp. ANA-3)
MQIRYFLALSLLPQVVLADESPTASASQCVIEPPVPRIVSQPGLSAADQEKIRIVSDRSN
AEMGKQAIFTGDVVFSQGDRHIAADEAILDQATEQFDANGNLVFQDSIFTVTADSLQAQM
RSNRATLKGAQYWLHGQQVHGDAEKLQITMNNNLILTNTNFTTCPPDNVSWLLEAEKIKI
NSEEEWGEIWNAKLRVADIPVFYIPYMTVPVSDKRKTGFLYPSFSTSTTNGFEVSAPYYW
NIAPEYDLTFTPNYMSSRGLFTKTEFRYLAGEAQSGRLNLEYLGNDQMISGSPNRYLYNW
QHQGAIDKNWRVLANFTEVSDNNYFNDLKSDVNRATDNQLSRIGEVSYFERDWDISTRVQ
DIKVLGEDEKPYQVMPQVNFNYRAADFWNNLDFGFNSELTNFAHQDSDMNTATRLHMAPS
LTLPIHGPSGSLTSQVKLMQTNYWQEKNNSGFDGLDDTVSRTIPQVRINGQINFERFTEL
FDQNYRQTLEPQFQYLYVGYEDQRGIGIYDTAQLQDDYFGLFRDRRFSGLDRIADANQVT
LGVTTRFFDDHNQEATKFSLGQILYLQDSKLGYEDNLFEQNQSTSVLAAELDTRLSHDWY
LGAAIQYDTNSSDNKKTEVTLDFRPEANKLLQLSYRYVPDLLNSNTNDLVNISQAGVRGA
WPINDSLYFVGNWYYDLNESRSIETYTGFQYESCCYAIRLSYHYRIKTNYDDNIGSAVID
EREQFESGVYLNLVIKGLGGSGPLGVSDMLNDGLFNYRKPLYLRN