Protein Info for Shewana3_3203 in Shewanella sp. ANA-3

Name: djlA
Annotation: Dna-J like membrane chaperone protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details PF27507: DjlA_TM" amino acids 1 to 35 (35 residues), 54 bits, see alignment 2.3e-18 PF05099: TerB" amino acids 60 to 170 (111 residues), 46.4 bits, see alignment E=7e-16 PF00226: DnaJ" amino acids 196 to 253 (58 residues), 41.4 bits, see alignment E=1.9e-14

Best Hits

Swiss-Prot: 96% identical to DJLA_SHEON: Co-chaperone protein DjlA (djlA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K05801, DnaJ like chaperone protein (inferred from 99% identity to she:Shewmr4_0911)

Predicted SEED Role

"DnaJ-like protein DjlA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L058 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Shewana3_3203 Dna-J like membrane chaperone protein (RefSeq) (Shewanella sp. ANA-3)
MRLWGKFFGFVIGFMFGRIFGALLGLWLGHLYDKRAGGGASFSQILGQAKNRQGIFFNTT
FAVMGHVAKASGRVTETDIRIATMLMDQMRLTGEARKEAQQAFREGKEPDFDLRSSLQAF
RAVTQGRQELVQMFIEIQIQTALSDGELDAAEHAILMTVAQELGYGRGQLDELLKRWQAE
YRFHQTSNGNKTSITDAYHLLGINAEATDQEVKRAYRKLMNEHHPDKLVAKGLPPEMMEI
ANRKAQDIQAAYDRVKSERGMR