Protein Info for Shewana3_3191 in Shewanella sp. ANA-3

Annotation: sulfate ABC transporter, inner membrane subunit CysW (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 62 to 86 (25 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 199 to 223 (25 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 15 to 274 (260 residues), 419.2 bits, see alignment E=6.4e-130 TIGR00969: sulfate ABC transporter, permease protein" amino acids 15 to 272 (258 residues), 341.6 bits, see alignment E=3.5e-106 PF00528: BPD_transp_1" amino acids 78 to 271 (194 residues), 47 bits, see alignment E=1.3e-16

Best Hits

Swiss-Prot: 60% identical to CYSW_ECOLI: Sulfate transport system permease protein CysW (cysW) from Escherichia coli (strain K12)

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 100% identity to she:Shewmr4_3014)

MetaCyc: 60% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysW (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L046 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Shewana3_3191 sulfate ABC transporter, inner membrane subunit CysW (RefSeq) (Shewanella sp. ANA-3)
MNSFKPLRVGEAPLIKWSLITLAVFLAMVLLLLPLVSIFQQAFVGGWERYIEHLSQPDSL
HAIGLTLMVAALTVPINLVFGVLLAWSVTRFEFPGRKLLITLIDIPFAVSPVVAGLLYLL
LYGNSGWLGAWLFEHDLQIMFAWPGILLVTIFVTCPFVARELIPLMQQQGASEEEAAVIL
GASWWQLFRRVTLPNIKWALIYGVILTNARAVGEFGAVAVVSGNIRGETNTLPLHVQLLY
EDYQAEAAFASASLLALIALCTLLLKALVEWRQQRSLSANDNQEQSQSL