Protein Info for Shewana3_3167 in Shewanella sp. ANA-3

Annotation: CDP-diacylglycerol--serine O-phosphatidyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 100% identity to shn:Shewana3_3167)

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.8

Use Curated BLAST to search for 2.7.8.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L022 at UniProt or InterPro

Protein Sequence (272 amino acids)

>Shewana3_3167 CDP-diacylglycerol--serine O-phosphatidyltransferase (RefSeq) (Shewanella sp. ANA-3)
MQNSTNQTVKNKGIYLLPNLFTTAGLFSGFYAVIASMNANFEAAAIAIFVAMICDGLDGR
VARLTNTQSDFGAEYDSMADMVSFGMAPALLAYNWALADLGKVGWLAAFIYCAGAALRLA
RFNTQVGVADKRYFQGLASPAAAAVIAGSIWLGNQYNLDGKNISWIAGLITAITGLLMVS
NFRYHSFKEIDWRGKVNFIAILFVVGVFVVVSVQPALILCIGFYLYAISGPVITIRTVRK
LKVAHIVGDGEHEKEQDAGEGPKSSTNSADKP