Protein Info for Shewana3_3154 in Shewanella sp. ANA-3

Annotation: putative sulfate transporter YchM (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 590 transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 133 to 156 (24 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 285 to 308 (24 residues), see Phobius details amino acids 366 to 396 (31 residues), see Phobius details amino acids 416 to 446 (31 residues), see Phobius details TIGR00815: sulfate permease" amino acids 24 to 571 (548 residues), 391.8 bits, see alignment E=2.4e-121 PF00916: Sulfate_transp" amino acids 34 to 420 (387 residues), 263.3 bits, see alignment E=3.1e-82 PF01740: STAS" amino acids 475 to 571 (97 residues), 60.3 bits, see alignment E=1.4e-20

Best Hits

KEGG orthology group: K03321, sulfate permease, SulP family (inferred from 100% identity to shn:Shewana3_3154)

Predicted SEED Role

"Putative sulfate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L009 at UniProt or InterPro

Protein Sequence (590 amino acids)

>Shewana3_3154 putative sulfate transporter YchM (RefSeq) (Shewanella sp. ANA-3)
MDPHVSHSAHLFSLRIAHALSEACVKDKYSVKRFGQDLLAGLTVGIIAIPLAMALAIASG
VAPQYGLYTAIVGGFIIAMTGGSRYSVSGPTAAFVVLLYPIAQQFGLAGLLIATVMSGMM
LVAMAMLRLGRLILYIPESVTLGFTAGIGVVIATLQLKDFFGLHIEHMPEQYFSKIMALG
QALPSLHLPSLLVAAATLATMLLWPKLKLPVPAHLPAIALGSILALVLNAMGADIETIGT
RFHYQLSDGSVGTGIPAVLPHFEWPWLQTGANGQTFEFNLATFQALLPAAFAIAMLGAIE
SLLCAVVLDGMTGKRHSANSELLGQGIGNIITPFFGGIPATAAIARSAANVKAGAQSPIA
SMIHAIVVLVGLVALAGVLAYLPMSAMAALLLVVAWNMSEAPKAVHLLKTAPTSDILVFL
TCFSLTVIFDMVIAISVGIILAALLFMKEIAEMTKLYDISSNKRYVDHPLPADWAVIKIN
GPLFFAAADRIFAEIASLTQDKQVIVLYLDGVSILDAGGLAALNKLIDKCKLNHTKLIIA
DLQFQPIRTLARAKVQPIEGVLKFYPTLREALAEAPVPEQIIESSTTVTH