Protein Info for Shewana3_3132 in Shewanella sp. ANA-3

Annotation: type IV pilus modification protein PilV (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details PF07963: N_methyl" amino acids 11 to 36 (26 residues), 33.7 bits, see alignment 9.7e-13 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 13 to 33 (21 residues), 27 bits, see alignment (E = 2.9e-10) TIGR02523: type IV pilus modification protein PilV" amino acids 13 to 150 (138 residues), 69.5 bits, see alignment E=4.1e-23

Best Hits

KEGG orthology group: K02671, type IV pilus assembly protein PilV (inferred from 100% identity to shn:Shewana3_3132)

Predicted SEED Role

"Type IV fimbrial biogenesis protein PilV" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZY7 at UniProt or InterPro

Protein Sequence (186 amino acids)

>Shewana3_3132 type IV pilus modification protein PilV (RefSeq) (Shewanella sp. ANA-3)
MTKFERLTHNRIQRGFSLIEVLVALVILVIGLIGIFNLHIVAKRGSFESFQQTQASYYAN
DIINRMKLNRTQLDSYAGEYTGAPSSVAKVCENTTLCNPTELKLWDIFEWQSSLTGESET
VGTQNVGGLDSPTACIEVNNRDVLVVITWRGIRETNIDTSAVADAADTCGADTKNRRIFS
LKTVII