Protein Info for Shewana3_3118 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 19 to 40 (22 residues), see Phobius details amino acids 52 to 78 (27 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 212 to 241 (30 residues), see Phobius details amino acids 253 to 272 (20 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details PF01925: TauE" amino acids 53 to 299 (247 residues), 79.3 bits, see alignment E=1.8e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3118)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZX3 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Shewana3_3118 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MLPYGLIFKRRKINLSQYYRPMAIVLVLLSAWLCWLVQFHQPVELIKQYGQFLFLGITGA
IFANATGAGGGVIFIPVFSSLNFSEAQSVSTSFMIQCFGMTAGAISWSGYYRRHHHQDKT
WSGFIPSILLAATCSILGLWSSQLWHLNSPSSLHTSFSLFSIILGIAIIISSQRRTLQSH
RLNALDYCWLAIIGYLGGIITAWLSVGVGELLVIYLMLRGVCAKMAVAIGVVVSAITVWS
ASPIHVFASDSHALFELVLFAGPGAIIGGLLARKLALFLPVKTLKLFFSSWIILTGFVMI