Protein Info for Shewana3_3114 in Shewanella sp. ANA-3

Updated annotation (from data): N-acetylglucosamine kinase (EC 2.7.1.59)
Rationale: Specifically important for: D-Glucosamine Hydrochloride; N-Acetyl-D-Glucosamine. The first step in NAG catabolism. The phenotype on glucosamine is strong and is present on both strands, but is not conserved. It may be a polar effect. (SEED_correct)
Original annotation: ATPase, BadF/BadG/BcrA/BcrD type (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF01869: BcrAD_BadFG" amino acids 13 to 274 (262 residues), 105.9 bits, see alignment E=1.4e-34

Best Hits

KEGG orthology group: None (inferred from 99% identity to she:Shewmr4_2935)

Predicted SEED Role

"N-acetylglucosamine kinase of eukaryotic type (EC 2.7.1.59)" in subsystem Chitin and N-acetylglucosamine utilization (EC 2.7.1.59)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.59

Use Curated BLAST to search for 2.7.1.59

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZW9 at UniProt or InterPro

Protein Sequence (302 amino acids)

>Shewana3_3114 N-acetylglucosamine kinase (EC 2.7.1.59) (Shewanella sp. ANA-3)
MGLVQTKDQQLFIGVDGGGSKCRATIYTADGTVLGTGVAGRANPLHGLAQTFASIEASTR
QALLDAGMKETDSHLLVAGLGLAGVNVPRLYQDVISWQHPFAAMYVTTDLHTACIGAHRG
ADGAVIITGTGSCGYAHVGDDSLSIGGHGFALGDKGSGAWLGLKAAEHVLLALDGFATPT
ALTEMLLKHFGVSDALGIVEHLAGKSSSCYAELARSVLDCANAGDEVARGIVQEGADYIS
EMARKLFSLNPVRFSMIGGLAEPLQAWLGSDVVAKISETLAPPELGAMYFAQQQFNSVNI
NE