Protein Info for Shewana3_3111 in Shewanella sp. ANA-3

Updated annotation (from data): transmembrane glucosamine N-acetyltransferase NagX
Rationale: Specifically important for glucosamine utilization. NagX proteins are distantly related to human HGSNAT (uniprot:Q68CP4), which is a transmembrane acetyl-CoA:alpha-glucosaminide N-acetyltransferase.
Original annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 41 to 63 (23 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details amino acids 324 to 345 (22 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3111)

MetaCyc: 100% identical to D-glucosamine N-acetyltransferase (Shewanella sp. ANA-3)
Glucosamine N-acetyltransferase. [EC: 2.3.1.3]

Predicted SEED Role

"N-acetylglucosamine related transporter, NagX" in subsystem Chitin and N-acetylglucosamine utilization

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZW6 at UniProt or InterPro

Protein Sequence (395 amino acids)

>Shewana3_3111 transmembrane glucosamine N-acetyltransferase NagX (Shewanella sp. ANA-3)
MSTTAPESITNTGVNAQEAAAKKRQSKPRLMSLDALRGFDMFWILGGEALFGALLMLTGW
AGWQWGDTQMHHSEWNGFRFYDLIFPLFIFLSGVALGLSPKRLDKLPMQERMPVYRHGIK
RLFLLLLLGILYNHGWGTGAPADPEKVRYASVLGRIAFAWFFAALLVWHTSLRTQVLVAL
GILVAYGAVQLWLPFPGGQAGVLSPTESINAYVDSLLLPGVSYQGRTPDPEGVLSTLPAV
VNALAGVFVGHFIVKSHPKGEWAKVGLLSVAGGVCLALGWLLGGVIPVNKELWTSSFVLV
TSGWSMLLLALFYALVDVLKWQKLAFIFVVIGTNAIIIYLASSLVDWKYIAQSVFGGVIA
VLPENAQPLGAVIGLLTVQWLVLYWMYRRNIFVRI