Protein Info for Shewana3_3090 in Shewanella sp. ANA-3

Annotation: luciferase family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 TIGR03558: luciferase family oxidoreductase, group 1" amino acids 26 to 345 (320 residues), 412.4 bits, see alignment E=6.9e-128 PF00296: Bac_luciferase" amino acids 40 to 264 (225 residues), 148.1 bits, see alignment E=1.9e-47

Best Hits

Swiss-Prot: 52% identical to YVBT_BACSU: Uncharacterized protein YvbT (yvbT) from Bacillus subtilis (strain 168)

KEGG orthology group: K00494, alkanal monooxygenase (FMN-linked) [EC: 1.14.14.3] (inferred from 100% identity to shn:Shewana3_3090)

Predicted SEED Role

"Bacterial luciferase family protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.14.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZU5 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Shewana3_3090 luciferase family protein (RefSeq) (Shewanella sp. ANA-3)
MAISSTSTSATPSQAVTKSPLADIPFSLLELAPVRQGASIGDTLRASLQYAKVADDLGFN
RFWFAEHHNMPGIASAATSVLIGYIAENTKRIRVGAGGIMLPNHAPLVVAEQFGTLESLY
PGRIDLGLGRAPGSDQITSRALNRDMSRAEQFPAEVSELQTLLGDYNGRHPVRAIPGEGT
HVPIWLLGSSLFSAQLAAQRGLPYVFAGHFAPRFLYDAIEIYRRDFKPSKVLDKPYVMLG
LPLIAAETDAEAEYLSTTSKQRVLALIRGEPLWLKPPVDSMDGLWSEQEKTYVDNFLGLS
VTGGPTSIKHRLEMIVKELGVDEFIFTNDLYDQDKRERALQILMEIKGS