Protein Info for Shewana3_3082 in Shewanella sp. ANA-3

Annotation: putative glycerol-3-phosphate acyltransferase PlsY (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00023: acyl-phosphate glycerol 3-phosphate acyltransferase
  • amino acids 5 to 196 (192 residues), 233.3 bits, E=1.1e-73
• PF02660: G3P_acyltransf
  • amino acids 13 to 186 (174 residues), 178.6 bits, E=5.4e-57

Best Hits

Swiss-Prot: 100% identical to PLSY_SHESA: Glycerol-3-phosphate acyltransferase (plsY) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K08591, glycerol-3-phosphate acyltransferase PlsY [EC: 2.3.1.15] (inferred from 99% identity to she:Shewmr4_2903)

Predicted SEED Role

"Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• oleate biosynthesis III (cyanobacteria) (2/3 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• diacylglycerol and triacylglycerol biosynthesis (3/7 steps found)
• palmitoyl ethanolamide biosynthesis (2/6 steps found)
• superpathway of stearidonate biosynthesis (cyanobacteria) (2/6 steps found)
• stigma estolide biosynthesis (2/7 steps found)
• anandamide biosynthesis II (2/8 steps found)
• anandamide biosynthesis I (4/12 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

See A0KZT7 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Shewana3_3082 putative glycerol-3-phosphate acyltransferase PlsY (RefSeq) (Shewanella sp. ANA-3)
MSQLTLTLLMIVAAYLAGSVSSAVLVCRMRGLPDPRLQGSGNPGATNVLRIGGASSAAMV
LFFDMLKGALPTYLAYLMGIDAISLGLIAIAACLGHIYPIFFGFKGGKGVATAFGAMAPI
GDDLAICLMASWVVLVLISRYSSLAAIITALLAPLYTWWLDDRFTIPVAMLSTLIIIRHK
ENIQRLLKGEESKVSRKKRPKAP