Protein Info for Shewana3_3079 in Shewanella sp. ANA-3

Annotation: undecaprenyl pyrophosphate phosphatase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 249 to 265 (17 residues), see Phobius details TIGR00753: undecaprenyl-diphosphatase UppP" amino acids 6 to 257 (252 residues), 251.6 bits, see alignment E=5.1e-79 PF02673: BacA" amino acids 7 to 259 (253 residues), 289.2 bits, see alignment E=1.8e-90

Best Hits

Swiss-Prot: 100% identical to UPPP_SHESA: Undecaprenyl-diphosphatase (uppP) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K06153, undecaprenyl-diphosphatase [EC: 3.6.1.27] (inferred from 99% identity to she:Shewmr4_2900)

Predicted SEED Role

"Undecaprenyl-diphosphatase (EC 3.6.1.27)" (EC 3.6.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZT4 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Shewana3_3079 undecaprenyl pyrophosphate phosphatase (RefSeq) (Shewanella sp. ANA-3)
MDTFQVIILALIQGLTEFLPISSSAHLILPAQLLGWEDQGLSFDVAVNTGSLFAVVIYFR
NELWAMFKAWIASMVKGQHSDDSKLAWWIILATLPAVFFGFMAKDFIETHLRSAGVIAVT
TVVFGLLLWWADKMSRRDLTVYQTGWRKALLIGFAQALALIPGTSRSGATMTAALMLGLS
RDAAARFSFLMSVPVSLGAAILVGKDLAESPLPIDYQALTLGTVISFVAAYLCIHYFLKI
ISRMGMTPFVIYRLILGAVLCGFIFL