Protein Info for Shewana3_3073 in Shewanella sp. ANA-3

Annotation: citrate transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 17 to 40 (24 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 126 to 156 (31 residues), see Phobius details amino acids 168 to 195 (28 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 269 to 286 (18 residues), see Phobius details amino acids 306 to 324 (19 residues), see Phobius details amino acids 375 to 397 (23 residues), see Phobius details amino acids 409 to 435 (27 residues), see Phobius details PF03600: CitMHS" amino acids 43 to 381 (339 residues), 82.9 bits, see alignment E=1.2e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to she:Shewmr4_2894)

Predicted SEED Role

"Arsenic efflux pump protein" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZS8 at UniProt or InterPro

Protein Sequence (436 amino acids)

>Shewana3_3073 citrate transporter (RefSeq) (Shewanella sp. ANA-3)
MPLNSSPLACHDIKTAVGIAVMLYTFLIILAVLALLSIIFEEVTHLNKAKTTLFFGCISW
VALFMAAGDANHEKLVAHQLNENLLEIATLWLFLMSTMTFVAYLNAKGMIQIMVQKLFPQ
KVSVRLLMIQVALFALILSAFCDNVTATLVSLGLLTTFKLEKQMRRRMAVLIIFAVNSGG
VALITGDVTTLMIFLGGHVHISELLMLFIPSAVSVILLATLFSLKAEGVVSTTPIKHSYQ
TVDLLIALVFFCTILMTMLLNILFGIPPVLTFLTGLSIMFLIGHTTRSDKEEIKILEYIR
QVEYDTLLFFLGILLLVGMLKEIGTLDMLTEAYSLFNPNISNFVTGMGSALIDNVPLTAA
LLKAEPVLNTPEWLGLTYSVGVGGSLLVIGSAAGIVAMSKVKELTFVSYLKYVPALFLCY
SVGYALTLFLAYNFFA