Protein Info for Shewana3_3071 in Shewanella sp. ANA-3

Annotation: glutamate-1-semialdehyde aminotransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 TIGR00713: glutamate-1-semialdehyde-2,1-aminomutase" amino acids 4 to 423 (420 residues), 638 bits, see alignment E=3e-196 PF00202: Aminotran_3" amino acids 33 to 395 (363 residues), 269.2 bits, see alignment E=2.6e-84

Best Hits

Swiss-Prot: 100% identical to GSA_SHESA: Glutamate-1-semialdehyde 2,1-aminomutase (hemL) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K01845, glutamate-1-semialdehyde 2,1-aminomutase [EC: 5.4.3.8] (inferred from 100% identity to shn:Shewana3_3071)

MetaCyc: 70% identical to glutamate-1-semialdehyde 2,1-aminomutase (Escherichia coli K-12 substr. MG1655)
Glutamate-1-semialdehyde 2,1-aminomutase. [EC: 5.4.3.8]

Predicted SEED Role

"Glutamate-1-semialdehyde aminotransferase (EC 5.4.3.8)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 5.4.3.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.3.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZS6 at UniProt or InterPro

Protein Sequence (430 amino acids)

>Shewana3_3071 glutamate-1-semialdehyde aminotransferase (RefSeq) (Shewanella sp. ANA-3)
MTRSEALFEQAKKTIPGGVNSPVRAFNGVGGSPLFIEKADGAYIYDADGKAYIDYVGSWG
PMILGHNHPKIREAVLAAVHNGLSFGAPTELEVQMAEKVIAMVPSIEQVRMVSSGTEATM
SAIRLARGFTNRDKILKFEGCYHGHADCLLVKAGSGALTLGQPSSPGIPEDFAKHTLTAV
YNDLDSVRSLFEQYPTEISCIIIEPVAGNMNCIPPIPGFLEGLRAMCDEFGALLIIDEVM
TGFRVSRSGAQGHYGVTPDLTTLGKVIGGGMPVGAFGGRKEVMQFIAPTGPVYQAGTLSG
NPIAMSAGLAQMEALCEEGLYEALSAKTKRIAEGFKAAADKHGIPMAINYVGGMFGFFFT
EQEQITRFDQVTKCNIEHFRTFYHGMLDEGVYLAPSAYEAGFLSMAHGEEELRLTLEAAD
RVLGRMKAAM