Protein Info for Shewana3_3061 in Shewanella sp. ANA-3

Annotation: transcriptional regulator domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 716 transmembrane" amino acids 146 to 167 (22 residues), see Phobius details PF00486: Trans_reg_C" amino acids 39 to 113 (75 residues), 53.4 bits, see alignment E=5.4e-18 PF07676: PD40" amino acids 286 to 308 (23 residues), 14 bits, see alignment (E = 1e-05) amino acids 336 to 348 (13 residues), 11.9 bits, see alignment (E = 4.8e-05) amino acids 511 to 524 (14 residues), 16.9 bits, see alignment (E = 1.3e-06)

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3061)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZR6 at UniProt or InterPro

Protein Sequence (716 amino acids)

>Shewana3_3061 transcriptional regulator domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MKDKSKLGFYLGSCRIDPSDNSILFQTQGDETSSNESAKVSLQPKFIEVLSYLALRYPHV
VTRDELITQVWEGNAYVGTKALTNAIWHLRQQLLPLDVDGGVIETVRKAGYRLLLPPIYD
QLDDTEEDLRQTTETKLQHANQRLRLMAMVLGAVAVVSSLFIGMHLYQDKQRMTDTQMTV
LTRDPGSERYPRLSHDRRWLVYGASRPGVTSSLYLKDFKREDVPARQLTPSTSVELRAVW
SLDDTKLFFASRSHATGKCTITQLTLATNEMLALAPCSTDMAAIDISPDGQYLAYISSHE
ADKVGGIYRLTLAKADATAERLSCESQCNYEDRDLAFSPDGKWLAIARRFSNISEDIFIR
DLANANEKRLTQGLEDIRGLSWTPNSQALVFATEDSGSRNGFTIDIETAHIRPLDVEGMS
YPSSVSDEGELVYHQYRRQFQMAYFSLGDKVPGSLFPLLYSGISHRNPHYSPEAGRIVFV
SSDTGYNEIWTSDIKGQKLEQHTQLKSRVAYPRWSPDGSKIAFIAPDDRNEGNRIFILDL
TNKNITALASSYHNHGRPSWNWQGTAVFASTSDGITEFYLDNSAPKVISPLSMAVGFAKS
ATELVFSRYGVNGLWLINLAQPEEVTQLISSKVFRSGNNWAMTADGVYFKSSNGNEQRLN
YWEASSQQVTPLLRVPRSSLSGFGSMTYIPESNRLVMTLDGFPQRDIILLKHKLLQ