Protein Info for Shewana3_3040 in Shewanella sp. ANA-3

Annotation: prolipoprotein diacylglyceryl transferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 184 to 201 (18 residues), see Phobius details amino acids 208 to 226 (19 residues), see Phobius details amino acids 238 to 262 (25 residues), see Phobius details TIGR00544: prolipoprotein diacylglyceryl transferase" amino acids 4 to 262 (259 residues), 258.8 bits, see alignment E=3e-81 PF01790: LGT" amino acids 28 to 262 (235 residues), 268.6 bits, see alignment E=2.2e-84

Best Hits

Swiss-Prot: 100% identical to LGT_SHESA: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (lgt) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K13292, phosphatidylglycerol:prolipoprotein diacylglycerol transferase [EC: 2.-.-.-] (inferred from 100% identity to she:Shewmr4_2862)

Predicted SEED Role

"Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)" (EC 2.4.99.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZP6 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Shewana3_3040 prolipoprotein diacylglyceryl transferase (RefSeq) (Shewanella sp. ANA-3)
MALNFPNIDPVIVKFGPFDIFGQTFEPALRWYGFTYLVGFVAAMWLLNRQADRSNGLWSR
EQVSDLLFYGFLGVILGGRIGYVLFYHFDYFLASPMYLFKISEGGMSFHGGLMGVITAMI
YIAWKQKRTFFAVADMVAPVVPIGLGAGRIGNFINGELWGRVTDVPWAMVFPSGGPEPRH
PSQLYQFALEGVALFLLLYWFSKRTKKVGAVSGMFLLGYGIFRVIVETVRQPDAQLGLYW
GFMTMGQILSVPMILFGLYLILRPEGKQ