Protein Info for Shewana3_3039 in Shewanella sp. ANA-3

Name: thyA
Annotation: thymidylate synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 PF00303: Thymidylat_synt" amino acids 2 to 264 (263 residues), 433.6 bits, see alignment E=1.1e-134 TIGR03284: thymidylate synthase" amino acids 2 to 85 (84 residues), 147.4 bits, see alignment E=2.5e-47 amino acids 84 to 264 (181 residues), 310.2 bits, see alignment E=6.6e-97

Best Hits

Swiss-Prot: 100% identical to TYSY_SHESA: Thymidylate synthase (thyA) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K00560, thymidylate synthase [EC: 2.1.1.45] (inferred from 100% identity to shn:Shewana3_3039)

MetaCyc: 80% identical to thymidylate synthase (Escherichia coli K-12 substr. MG1655)
Thymidylate synthase. [EC: 2.1.1.45]

Predicted SEED Role

"Thymidylate synthase (EC 2.1.1.45)" in subsystem Folate Biosynthesis (EC 2.1.1.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZP5 at UniProt or InterPro

Protein Sequence (264 amino acids)

>Shewana3_3039 thymidylate synthase (RefSeq) (Shewanella sp. ANA-3)
MQQYLDLMKHILAEGVDKSDRTGTGTRSVFGYQMRFDLSKGFPLVTTKKCHMRSIIHELL
WFLKGDTNIAYLRENKVSIWDEWADENGDLGPVYGAQWRSWPTQSGDAIDQIAQVIAQIK
SQPDSRRLIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS
YALLTMMVAQQCDLALGDFVWTGGDTHLYSNHMEQTALQLSREPRQLPTMTILRKPASIF
DYQFEDFELTHYDPHPHIKAPVAV