Protein Info for Shewana3_3038 in Shewanella sp. ANA-3

Annotation: Na+/H+ antiporter NhaA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 signal peptide" amino acids 12 to 15 (4 residues), see Phobius details amino acids 33 to 36 (4 residues), see Phobius details transmembrane" amino acids 16 to 32 (17 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 92 to 115 (24 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 181 to 198 (18 residues), see Phobius details amino acids 209 to 237 (29 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details amino acids 288 to 311 (24 residues), see Phobius details amino acids 328 to 350 (23 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details PF06965: Na_H_antiport_1" amino acids 7 to 380 (374 residues), 496.4 bits, see alignment E=2.5e-153 TIGR00773: Na+/H+ antiporter NhaA" amino acids 8 to 380 (373 residues), 547.9 bits, see alignment E=5.9e-169

Best Hits

Swiss-Prot: 100% identical to NHAA_SHESA: Na(+)/H(+) antiporter NhaA (nhaA) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K03313, Na+:H+ antiporter, NhaA family (inferred from 100% identity to shn:Shewana3_3038)

MetaCyc: 61% identical to Na+:H+ antiporter NhaA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-129; TRANS-RXN-292

Predicted SEED Role

"Na+/H+ antiporter NhaA type" in subsystem Na(+) H(+) antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZP4 at UniProt or InterPro

Protein Sequence (389 amino acids)

>Shewana3_3038 Na+/H+ antiporter NhaA (RefSeq) (Shewanella sp. ANA-3)
MEKAIRNFLSQESAGGILLLVAVVLAMLMANSPLAGLYQGFLGTEVQVRVGALDLHKPLL
LWINDGLMALFFLLIGLEVKRELLEGALSSVAQASLPTFAAIGGMLVPAGIYLLFNYGDP
VTQVGWAIPAATDIAFALGIMALLGSRVPVALKVFLLALAIIDDLGVIVIIALFYSSDLS
TISLIIASIAIVGLVALNRKGVTALAPYGVLGLVLWVAVLKSGVHATLAGVIIAFCIPLR
AKDGSSPSEHLEHSLHPWSTFLILPVFAFANAGVALGNMSLDALISPVPVGIALGLMLGK
PIGVMLFSYVAVKLKLAQLPDGIGWKQIAPVAAMCGIGFTMSMFIASLAFEQADPMFGDL
ARLGTLIGSILAALIGYFWLSKVLPKKGV