Protein Info for Shewana3_3026 in Shewanella sp. ANA-3

Name: rnc
Annotation: ribonuclease III (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 TIGR02191: ribonuclease III" amino acids 12 to 223 (212 residues), 245.2 bits, see alignment E=2.7e-77 PF14622: Ribonucleas_3_3" amino acids 21 to 143 (123 residues), 126.8 bits, see alignment E=9e-41 PF00636: Ribonuclease_3" amino acids 39 to 128 (90 residues), 88.5 bits, see alignment E=7.1e-29 PF00035: dsrm" amino acids 157 to 224 (68 residues), 54.7 bits, see alignment E=1.9e-18

Best Hits

Swiss-Prot: 100% identical to RNC_SHESA: Ribonuclease 3 (rnc) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 99% identity to shm:Shewmr7_2930)

MetaCyc: 64% identical to RNase III (Escherichia coli K-12 substr. MG1655)
Ribonuclease III. [EC: 3.1.26.3]

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.3

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZN2 at UniProt or InterPro

Protein Sequence (226 amino acids)

>Shewana3_3026 ribonuclease III (RefSeq) (Shewanella sp. ANA-3)
MEPIKNLPRLCRTLGYEFKNIDLLTQALTHRSAANKHNERLEFLGDSILSIVISDALYHQ
FPKATEGDLSRMRATLVRGDTLTLIAKAFKLGDYLFLGPGELKSGGFRRESILADAVEAI
IGAIYLDSDLEVCRKLLLHWYAERLAEIQPGVNQKDAKTLLQEYLQGLKKPLPDYQVINI
EGDAHDQTFTVECRIDDLSESVIGVASSRRKAEQIAAAQVLELLKK