Protein Info for Shewana3_3011 in Shewanella sp. ANA-3

Annotation: hydroxylamine reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 TIGR01703: hydroxylamine reductase" amino acids 1 to 551 (551 residues), 744.9 bits, see alignment E=2.2e-228 PF03063: Prismane" amino acids 1 to 548 (548 residues), 538 bits, see alignment E=1.2e-165

Best Hits

Swiss-Prot: 100% identical to HCP_SHESA: Hydroxylamine reductase (hcp) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K00378, hydroxylamine reductase [EC: 1.7.-.-] (inferred from 100% identity to shm:Shewmr7_2914)

Predicted SEED Role

"Hydroxylamine reductase (EC 1.7.-.-)" in subsystem Nitrosative stress (EC 1.7.-.-)

Isozymes

Compare fitness of predicted isozymes for: 1.7.-.-

Use Curated BLAST to search for 1.7.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZL7 at UniProt or InterPro

Protein Sequence (554 amino acids)

>Shewana3_3011 hydroxylamine reductase (RefSeq) (Shewanella sp. ANA-3)
MFCIQCEQTIRTPAGNGCSYAQGMCGKLAATSDLQDLLIYMLQGVSVYATKARELGVINP
EVDTFVPKAFFSTLTNVNFDDERIIAYAKQAAEYRESLKNAYEAACEAAGKRAESLPPVA
QFVLGTSKPEMLSQAPVALLNKDKNEIHEDILGLRLLCLYGLKGAAAYMEHARVLGKTDA
EIAGRFHEIMAFLGEPSVDADKLFTTAMDIGQLNYRIMAMLDAGETEAFGHPEPTVVNTK
PVKGKAILVSGHDMKDLELILEQTAGKGINVYTHGEMLPALAYPAFKKYAHLVGNYGSAW
QNQQKEFANFPGAVVMTSNCIIDPNVGQYSDRIFTRSIVGWPGVTHVIGDDFSVVIDKAL
SLDGFQYDEIPHNITIGFARNALMAAAPTVVENVKNGSIKHFFLVGGCDGDKSERSYFTD
LAKSAPKDSVILTLGCGKYKFNKLEFGDINGIPRLLDIGQCNDAYSAIQLAIALSQIFEC
DINELPLNLVLSWFEQKAIVVLLTLLSLGVKNIRTGPTPPAFLTANLAKILEEKFGLRNT
TTVEADLKTMLNVA