Protein Info for Shewana3_3003 in Shewanella sp. ANA-3

Annotation: RDD domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 transmembrane" amino acids 21 to 49 (29 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 113 to 137 (25 residues), see Phobius details PF06271: RDD" amino acids 11 to 148 (138 residues), 67.7 bits, see alignment E=7e-23

Best Hits

KEGG orthology group: None (inferred from 99% identity to shm:Shewmr7_2906)

Predicted SEED Role

"FIG023103: Predicted transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZK9 at UniProt or InterPro

Protein Sequence (169 amino acids)

>Shewana3_3003 RDD domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MLNAEHANFPRAGFFRRLGAMIYDLLLAVAVYMFAGAIGFGIFFGLTASGLISMNGFEHV
SDALNGTPIYHGIYQLWLVLCVGTFYALFWSKGGQTLGMRAWRLKIQHPNGQNLSLITAY
ARIVWSLLGIGNLWVLINDDKLALQDMMTRSEVVVLSKEANQMRNWHGA