Protein Info for Shewana3_2988 in Shewanella sp. ANA-3

Annotation: DEAD/DEAH box helicase domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 PF04851: ResIII" amino acids 23 to 190 (168 residues), 46.1 bits, see alignment E=8e-16 PF00270: DEAD" amino acids 25 to 195 (171 residues), 172.3 bits, see alignment E=1.1e-54 PF00271: Helicase_C" amino acids 231 to 339 (109 residues), 101 bits, see alignment E=6.8e-33

Best Hits

Swiss-Prot: 44% identical to RHLB_PSEAB: ATP-dependent RNA helicase RhlB (rhlB) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: None (inferred from 99% identity to she:Shewmr4_2809)

MetaCyc: 40% identical to ATP-dependent RNA helicase SrmB (Escherichia coli K-12 substr. MG1655)
5.6.2.e [EC: 5.6.2.e]

Predicted SEED Role

"ATP-dependent RNA helicase VVA0939" in subsystem ATP-dependent RNA helicases, bacterial

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.6.2.e

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZJ4 at UniProt or InterPro

Protein Sequence (433 amino acids)

>Shewana3_2988 DEAD/DEAH box helicase domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MRFESFSFCPEILRAISDCGYQKMTPIQQQAIPAIRRGQDVLASAQTGTGKTAAFALPIL
QKMVENPSETLKSNARVLILTPTRELAAQVADNVEAYSKYLNFSVLTIYGGVKVETQAQK
LKRGADIIVATPGRLLEHLTACNLSLSSIDFLVLDEADRMLDMGFNADIQKILQAVNKKR
QNLLFSATFSSAVKKLANDMMVKPQVISADKQNTTADTVSQVVYPVEQRRKRELLSELIG
KKNWQQVLVFTATRDAADTLVKELNLDGIPSEVVHGEKAQGSRRRALREFVSGKVRVLVA
TEVAARGLDIPSLEYVVNFDLPFLAEDYVHRIGRTGRAGKSGVAISFVSREEERTLADIE
KLIGQKIRRITVPGYEVGSRDLLLKQLQTRRSFAKKQQRLDNVSEQIIAEKSMQGRRVKM
KVGQAPSKAKKLK