Protein Info for Shewana3_2982 in Shewanella sp. ANA-3

Annotation: short chain fatty acid transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 95 to 125 (31 residues), see Phobius details amino acids 136 to 161 (26 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details amino acids 303 to 326 (24 residues), see Phobius details amino acids 335 to 359 (25 residues), see Phobius details amino acids 380 to 390 (11 residues), see Phobius details amino acids 396 to 414 (19 residues), see Phobius details amino acids 420 to 441 (22 residues), see Phobius details PF02667: SCFA_trans" amino acids 1 to 440 (440 residues), 514.2 bits, see alignment E=1.9e-158

Best Hits

KEGG orthology group: K02106, short-chain fatty acids transporter (inferred from 100% identity to shn:Shewana3_2982)

Predicted SEED Role

"Short chain fatty acids transporter" in subsystem Polyhydroxybutyrate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZI8 at UniProt or InterPro

Protein Sequence (442 amino acids)

>Shewana3_2982 short chain fatty acid transporter (RefSeq) (Shewanella sp. ANA-3)
MLTKAAKPLVKLVDRYLPDPYIFVLLLTLVVLISAVVAEQKTPLEVINYWGDGFWALLSF
SMQMLLVLVAGFMLASSPPIKKLLDGIAGFAKSAPQAIILVTLVSLAASWINWGFGLVVG
ALFAKALARKVRVDYRLLVASAYSGFVVWHGGLAGSIPLTIATAGHFSESQIGIIPTSET
IFASFNLLLVLILFVVMPLVNRFMLPEEKDGIYVDPKALEDGAADDNAAQLTANTTRPAD
KLENSRLLGWSVGGAGLVYLGYYFAVQGGSLNLNLVNFLFLFLAIVLHQTPRSLLLSLNE
AIKGGAGIVIQFPFYAGIMAVMVQSGLAQSISEGFVAIASAESLPFWSFISAGIVNIFVP
SGGGQWAVQAPIMLPAAEALGADVARVAMAVAWGDAWTNLIQPFWALPVLAIAGLKARDI
MGFCLMQLLITGVIISIALSWF