Protein Info for Shewana3_2945 in Shewanella sp. ANA-3

Annotation: potassium efflux system protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 589 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 32 to 50 (19 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 213 to 230 (18 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details amino acids 325 to 343 (19 residues), see Phobius details amino acids 355 to 377 (23 residues), see Phobius details TIGR00932: transporter, monovalent cation:proton antiporter-2 (CPA2) family" amino acids 14 to 284 (271 residues), 260.3 bits, see alignment E=1.1e-81 PF00999: Na_H_Exchanger" amino acids 17 to 375 (359 residues), 203.1 bits, see alignment E=9.9e-64 PF02254: TrkA_N" amino acids 400 to 513 (114 residues), 82.3 bits, see alignment E=5.1e-27 PF27452: KefB_C" amino acids 519 to 587 (69 residues), 41.6 bits, see alignment E=1.8e-14

Best Hits

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 100% identity to shn:Shewana3_2945)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system protein KefB" in subsystem Glutathione-regulated potassium-efflux system and associated functions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZF2 at UniProt or InterPro

Protein Sequence (589 amino acids)

>Shewana3_2945 potassium efflux system protein (RefSeq) (Shewanella sp. ANA-3)
MEESSLLTSVLLFLLAAVIFVPLGKRFGAGPILSYLAAGVILGPGGMALVSDPAAVLHFA
ELGVVLMLFVLGLELNPSKLWELRSAIFGLGSGQLLLSWAAIGGLAWGFGLSIEAALVVG
AALSLSSTAFAVQLMSEHRLLTTPLGRDAFGVLLMQDLAVIPMLLLTAYLAPNSAQIEHH
AVPWYWTSVALVGFVLVGKYLLPRLLKLVASSGVREVLTAFALLLVMGSAELMEWLGLSA
GMGAFLAGIMLANSSYRHQLETDIEPFKGLLLGLFFMAVGMSMDLKLFLTDPLLILAILL
GMLLIKTLVLMLLGRLRHHAWRPSIALGLILAEGGEFAFVLLSQAQLSSIVDDKIAQILV
LAIGLSMAVTPMIFTLFRATKPKVVDTRLPDTINVTESEVVIAGFGRVGQITGRILASSG
IPFVALDKDASHVDVIRKYGGEVYFGDARRLDMLMSAGIARSRLLLLAVDNVEDSIEIAQ
QVKTHFPHINIVARARDRNHAYRLMSLGVTDVFRETFGSALSASEKILQGLGLSQVQANE
RVKIFAEHDKKLVIASSAHQHDLAKLLDLSNKGKAELESLMRGDRENVS