Protein Info for Shewana3_2942 in Shewanella sp. ANA-3

Annotation: isocitrate lyase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00463: ICL
  • amino acids 14 to 261 (248 residues), 205.4 bits, E=1.4e-64
  • amino acids 262 to 440 (179 residues), 171.9 bits, E=2.1e-54
• TIGR01346: isocitrate lyase
  • amino acids 14 to 261 (248 residues), 380.4 bits, E=6.2e-118
  • amino acids 262 to 440 (179 residues), 302.5 bits, E=2.4e-94
• PF13714: PEP_mutase
  • amino acids 87 to 311 (225 residues), 63.4 bits, E=2.4e-21

Best Hits

Swiss-Prot: 81% identical to ACEA_SALTY: Isocitrate lyase (aceA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01637, isocitrate lyase [EC: 4.1.3.1] (inferred from 100% identity to shm:Shewmr7_2844)

MetaCyc: 79% identical to isocitrate lyase (Escherichia coli K-12 substr. MG1655)
Isocitrate lyase. [EC: 4.1.3.1]

Predicted SEED Role

"Isocitrate lyase (EC 4.1.3.1)" in subsystem Serine-glyoxylate cycle (EC 4.1.3.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• glyoxylate cycle (6/6 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.1

Sequence Analysis Tools

See A0KZE9 at UniProt or InterPro

Protein Sequence (440 amino acids)

>Shewana3_2942 isocitrate lyase (RefSeq) (Shewanella sp. ANA-3)
MTKATQTSRQAQIDAIKKDWAENPRWKNVRRPYTAEEVVALRGSIVPENTIAKRGAAKLW
DLVNGGAKKGYVNSLGALTGGQAVQQAKAGIEAIYLSGWQVAADANLAGTMYPDQSLYPA
NSVPAVVARINNSFRRADQIQWSNGVNPEEENFVDYFLPIIADAEAGFGGVLNAFELMKS
MIDAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVETLVIARTD
ANAADLLTSDCDPYDRDFVTGERTSEGFYRVKAGLDQAISRGLAYAPYADLIWCETAKPD
LEEARRFAEAIHAQYPDQLLAYNCSPSFNWKKNLDDATIARFQQELSDMGYKYQFITLAG
IHNMWYNMFDLAYDYARGEGMKHYVEKVQEVEFAAAKKGYTFVAHQQEVGTGYFDQVTTV
IQGGQSSVTALTGSTEEEQF