Protein Info for Shewana3_2936 in Shewanella sp. ANA-3

Annotation: peptidyl-prolyl cis-trans isomerase, cyclophilin type (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00160: Pro_isomerase" amino acids 50 to 203 (154 residues), 147.4 bits, see alignment E=2.3e-47

Best Hits

KEGG orthology group: K01802, peptidylprolyl isomerase [EC: 5.2.1.8] (inferred from 100% identity to shn:Shewana3_2936)

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase PpiA precursor (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZE3 at UniProt or InterPro

Protein Sequence (211 amino acids)

>Shewana3_2936 peptidyl-prolyl cis-trans isomerase, cyclophilin type (RefSeq) (Shewanella sp. ANA-3)
MKRITGLLLASSLSLALGACGGSGDDELTPTIPTPDPTPPSLSADVCYLMSTTKGDLTLA
IDLTHMPITGKNFKQYVDKSFYNGTLFHRTINNFVIQGGGFTTGLQSKPTSAPIKNEAAV
GISNKRGTIAMARTTVPDSATSQFFINVLDNPQLDASASSYGYAVFGKVVEGMDVVDQIS
IVPTKTSNGFSDTPVNEILINSVMETTCPAA