Protein Info for Shewana3_2929 in Shewanella sp. ANA-3

Annotation: diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s) (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1009 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 36 to 58 (23 residues), see Phobius details amino acids 70 to 95 (26 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details PF07694: 5TM-5TMR_LYT" amino acids 31 to 188 (158 residues), 88.7 bits, see alignment E=1.4e-28 TIGR00229: PAS domain S-box protein" amino acids 206 to 322 (117 residues), 40 bits, see alignment E=3.8e-14 amino acids 327 to 455 (129 residues), 23.4 bits, see alignment E=5.3e-09 amino acids 453 to 575 (123 residues), 56.4 bits, see alignment E=3.3e-19 PF13426: PAS_9" amino acids 216 to 316 (101 residues), 22 bits, see alignment E=6.7e-08 amino acids 467 to 569 (103 residues), 51.5 bits, see alignment E=4.4e-17 PF08447: PAS_3" amino acids 227 to 296 (70 residues), 34.1 bits, see alignment 1.1e-11 amino acids 353 to 441 (89 residues), 48.1 bits, see alignment E=4.8e-16 amino acids 478 to 561 (84 residues), 37 bits, see alignment E=1.3e-12 PF00989: PAS" amino acids 461 to 557 (97 residues), 38.9 bits, see alignment E=3.1e-13 PF13188: PAS_8" amino acids 461 to 511 (51 residues), 24.8 bits, see alignment 6.4e-09 PF08448: PAS_4" amino acids 463 to 571 (109 residues), 26.1 bits, see alignment E=3.5e-09 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 579 to 741 (163 residues), 158.8 bits, see alignment E=1e-50 PF00990: GGDEF" amino acids 581 to 738 (158 residues), 178.9 bits, see alignment E=2.7e-56 PF00563: EAL" amino acids 758 to 994 (237 residues), 254.7 bits, see alignment E=3.2e-79

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2929)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZD6 at UniProt or InterPro

Protein Sequence (1009 amino acids)

>Shewana3_2929 diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s) (RefSeq) (Shewanella sp. ANA-3)
MDKSIFLPLVQNAALLLALVFLYDAIPKKHQRQYFLLWRLGIGLLIGGIGVTIMSTPWMY
EPGIIFDTRSVLLCVTGLFFGGLPTAIAVVMTAIYRISIGGAAMWVGLGVIISSGLIGVI
WRQQRKSYLANISGREIFSFAFVVHIVMLLWFFLLPDKVAIPVLQKIMLPVLTIYPLATW
LLSRLLSRRFELERDEQIRLQDDFLFRSQFNVGNIGIAITGVDQKWIKVNPRLCQMLKYS
EDELLHMTWKQLTHPDDVEADIVKFELMLAGKIDNYEMDKRFIAKDNSIVYTHMTVACKR
ANHQVLLVIAGYLDVTAQTLADREVLASREQLELVLSSSDLGVWDWDIRNDHIERNARSA
DILGCDIDMLNANSRQWMDSIVAEDRPKVLHSIEAHIRGETLQHKMEYRLKTLNRDIRWI
LDTGKVVSRDANNNALRMCGTYTDITEAKLIEESLKLSALVYDNSSEAMSVLDETGVIIT
VNAAFTAITGYSESEIRGQHIRLLYCDLNGHGFYTEMNNEIREKGEWQGEMRQRRKNNEE
YVIWLTINTIKDKDGQPYRRVALFSDITDKKQSEHLIWKQANYDTLTGLPNRRMLLEYLG
AEIKSADRNRNHFALMFLDLDYFKEVNDTLGHAMGDLLLIETASRLKSCVRDADVVARLG
GDEFTVVLSSMVDHKGIERVAEHILRRIAEPYVLGEETAYISASIGITLYPDDATSIEGL
LKHADQAMYAAKDQGRNRFNYFTPSMQEYAKYRMRLIQDLRQAVVSKEFELHYQPIVTMT
TGEVLKAEALLRWFHPERGYVSPAEFIPVAEDTGLIVEIGNWVFEQAARQSALWRKTFGV
DIQISVNKSPIQFRDEGTLLHNWLELLQKLDVTGTGVCVEITEGLLLDASMGVTEKLLAY
RDAGVQVSLDDFGTGYSSLAYLKKFDIDYLKIDQSFTRNIDTDESDQTLCEAIIVMAHKL
GMKVIAEGVETEAQRQVLLTAGCDYGQGYLFSKPVSATEFASKYLVKEA