Protein Info for Shewana3_2912 in Shewanella sp. ANA-3

Annotation: secretion protein HlyD family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 14 to 32 (19 residues), see Phobius details PF25917: BSH_RND" amino acids 50 to 235 (186 residues), 51.4 bits, see alignment E=1.6e-17 PF25954: Beta-barrel_RND_2" amino acids 241 to 280 (40 residues), 26.2 bits, see alignment 1.5e-09 PF25963: Beta-barrel_AAEA" amino acids 242 to 331 (90 residues), 38.6 bits, see alignment E=1.9e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2912)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZB9 at UniProt or InterPro

Protein Sequence (364 amino acids)

>Shewana3_2912 secretion protein HlyD family protein (RefSeq) (Shewanella sp. ANA-3)
MTDSTATPGKASKYATLGLLALIVILLLWYLVADRMTPYSSQARVQAFVVPIATEVTGQI
LKVYVQDNQDVAEGAPLFDIDPEPYDIALAKAKSDYETVLNSVKANNEGVKAAEAKLQAM
RASYNNSVKDAERQERLYRQDPGAISVRRLEIAQASRETASSQVTAAEADVRRAIEAAGV
NGENNSQLLSARSAVNKAERDRQNTHVVAPSRGVITDLNTDVGQFINAGAPAMTLIAIHD
VWISADLTENNLGNIKVGNRVSILLDSMPGQLFSGQIRSIGYGVDDGKKQAVGSLPTVSN
SRDWLRQAQRFPVKVSFSADDMPPAANLRVGGQADILVYTEEHGLMNPLGALYIRVMSLF
SYLY