Protein Info for Shewana3_2901 in Shewanella sp. ANA-3

Annotation: 1-deoxy-D-xylulose-5-phosphate synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13292: DXP_synthase_N
  • amino acids 11 to 282 (272 residues), 401.8 bits, E=3e-124
• TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase
  • amino acids 12 to 620 (609 residues), 978.6 bits, E=6.5e-299
• PF02775: TPP_enzyme_C
  • amino acids 118 to 183 (66 residues), 26.7 bits, E=8.9e-10
• PF02779: Transket_pyr
  • amino acids 320 to 480 (161 residues), 157.5 bits, E=5.4e-50
• PF02780: Transketolase_C
  • amino acids 496 to 611 (116 residues), 96.3 bits, E=2.7e-31

Best Hits

Swiss-Prot: 100% identical to DXS_SHESA: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 100% identity to shm:Shewmr7_2804)

MetaCyc: 71% identical to 1-deoxy-D-xylulose-5-phosphate synthase (Escherichia coli K-12 substr. MG1655)
1-deoxy-D-xylulose-5-phosphate synthase. [EC: 2.2.1.7]

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (6/6 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• methylerythritol phosphate pathway I (8/9 steps found)
• methylerythritol phosphate pathway II (8/9 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• isoprene biosynthesis I (8/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (8/12 steps found)
• superpathway of ergosterol biosynthesis II (10/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.7

Sequence Analysis Tools

See A0KZA9 at UniProt or InterPro

Protein Sequence (622 amino acids)

>Shewana3_2901 1-deoxy-D-xylulose-5-phosphate synthase (RefSeq) (Shewanella sp. ANA-3)
MSLDISQFPVLAQANTPNELRQLPQALLPQLADELREFLLKSVGMSSGHFASGLGTVELT
VALHYVYNTPFDRLIWDVGHQAYPHKILTGRRDRMHTIRQKNGLHPFPWREESEYDTFSV
GHSGTSISAALAMAVAAEKEQAGRKVVAVIGDGAMTGGMVFEAMNHAGDLHNDMLMVLND
NEMSISENVGALNNHLAQLMSGRLYTTIRESSKKVLKGMPVIKEMAKRTEEHLKGMVVPG
TLFEELGFNYIGPIDGHDVDALVETLRNMRSLKGPQVLHIMTKKGRGYEPAEKDPIGWHA
VPKFDPSQFKKPATKPGLPTFSQVFGKWLCDIAEQDEKVLGITPAMREGSGMVEFSQRFP
KQYFDAAIAEQHAVTLGAGFACEGFKPVVAIYSTFLQRGYDQLIHDVALQRLPVLFAIDR
GGIVGADGPTHQGAFDLSFMRCIPNMVIMAPSDENECRQMLYTGYCYDAGPSAVRYPRGS
ATGATQVEAMTALPIGKGVIKRLGKGIAMLNFGTTLAAALTAAESLDATVVDMRFVKPLD
VDLVKEMAQTHDVLVTVEENAIMGGAGSGVLELLQKLKMPKPVLQIGLPDEFIKHGSPEE
VTHDLQLDAEGMLAQINAFLAD