Protein Info for Shewana3_2877 in Shewanella sp. ANA-3

Annotation: phosphate binding protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02136: phosphate binding protein" amino acids 4 to 306 (303 residues), 305.7 bits, see alignment E=1.5e-95 PF12849: PBP_like_2" amino acids 37 to 293 (257 residues), 125.9 bits, see alignment E=2.5e-40 PF13531: SBP_bac_11" amino acids 47 to 304 (258 residues), 29 bits, see alignment E=8.9e-11

Best Hits

Swiss-Prot: 72% identical to PSTS_PSEAE: Phosphate-binding protein PstS (pstS) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 100% identity to shm:Shewmr7_2775)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZ85 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Shewana3_2877 phosphate binding protein (RefSeq) (Shewanella sp. ANA-3)
MKLKKLVGAMTLTAAGVFSATAMASVDQSLPTYEKASGVSGNLSSVGSDTLANMMTLWAE
EFKQMYPNVNIQIQAAGSSTAPPALTEGTSQFGPMSRKMKPNEEEAFEKHYGYKPTAVRV
AIDALAVFVHKDNPIKGLTVEQVDGIFSSTHKCGSSDIQRWGDLGLDGNWSAKDVQLYGR
NSVSGTYGYFKEHALCKGDFKANVNEQPGSASVVQSVSQSLNAIGYSGIGYKTAGVKAVA
IAKKGNEFIEATAENAANGTYPLSRYLYVYVNKQPNKDLAPMEKEFIRYVLSKQGQQVVE
KDGYVTLPKSVVAKDLEQLGIRL