Protein Info for Shewana3_2877 in Shewanella sp. ANA-3
Annotation: phosphate binding protein (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 72% identical to PSTS_PSEAE: Phosphate-binding protein PstS (pstS) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 100% identity to shm:Shewmr7_2775)Predicted SEED Role
"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0KZ85 at UniProt or InterPro
Protein Sequence (323 amino acids)
>Shewana3_2877 phosphate binding protein (RefSeq) (Shewanella sp. ANA-3) MKLKKLVGAMTLTAAGVFSATAMASVDQSLPTYEKASGVSGNLSSVGSDTLANMMTLWAE EFKQMYPNVNIQIQAAGSSTAPPALTEGTSQFGPMSRKMKPNEEEAFEKHYGYKPTAVRV AIDALAVFVHKDNPIKGLTVEQVDGIFSSTHKCGSSDIQRWGDLGLDGNWSAKDVQLYGR NSVSGTYGYFKEHALCKGDFKANVNEQPGSASVVQSVSQSLNAIGYSGIGYKTAGVKAVA IAKKGNEFIEATAENAANGTYPLSRYLYVYVNKQPNKDLAPMEKEFIRYVLSKQGQQVVE KDGYVTLPKSVVAKDLEQLGIRL