Protein Info for Shewana3_2860 in Shewanella sp. ANA-3

Annotation: major facilitator transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 46 to 69 (24 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 299 to 322 (24 residues), see Phobius details amino acids 334 to 353 (20 residues), see Phobius details amino acids 362 to 381 (20 residues), see Phobius details PF07690: MFS_1" amino acids 31 to 349 (319 residues), 83.5 bits, see alignment E=7e-28

Best Hits

KEGG orthology group: K03449, MFS transporter, CP family, cyanate transporter (inferred from 100% identity to shn:Shewana3_2860)

Predicted SEED Role

"MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZ68 at UniProt or InterPro

Protein Sequence (398 amino acids)

>Shewana3_2860 major facilitator transporter (RefSeq) (Shewanella sp. ANA-3)
MSHILSTRGNQLMIGVSLLLIGLNLRPILASVGPLLPSIQQDISLSFALASMLTLLPVLA
MGMGCFVGFKIAKGLGFANTVTVSLLFLLIATAMRFWVETANALICSALLAGMGIALIQT
LMPTLIKQNFADKTPLMMGLYVTAIMGGAALAASSAPFIAADLGWRAGLGHWTWLALIAI
LLWIVSRKHLALPSHTDKQAEYSFWRYRRSWLLALFFALGTSCYVCVLAWLAPYAIELGY
SQTQAGLALGFLTSMEVIAGLVFPWLASKSTDRRAIIALLCLLQLIGFMGFALAPQVSIF
LWAALAGLGIGGIFPLSLIVTMDHQQNPLLAGKLTAFVQGIGYSIAAISPWIAGLIRDNF
QSFNMAWLLLAALSVIAYLLSRQFNPSGYAQHYRQVIA