Protein Info for Shewana3_2851 in Shewanella sp. ANA-3

Annotation: transport-associated (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF04972: BON" amino acids 33 to 98 (66 residues), 59.6 bits, see alignment E=1.5e-20 amino acids 113 to 180 (68 residues), 59.6 bits, see alignment E=1.5e-20

Best Hits

KEGG orthology group: None (inferred from 99% identity to shm:Shewmr7_2744)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZ59 at UniProt or InterPro

Protein Sequence (182 amino acids)

>Shewana3_2851 transport-associated (RefSeq) (Shewanella sp. ANA-3)
MKNTTTLALTTLLVGSISLNVAAAQDWKDDAKDAWLDGKAETTLLLNTNLNSFDIMTDVK
NGHVTLTGQVESSVDKALAAELIKSLDGVKGVDNKLTVMKEDEGTNEVVKTLTDSKVATV
VKTRLLFSTDVSGTQINVDVADGVVTLQGEVASDAERQLALTIAKNTDDVKKVVDKIKVK
TS