Protein Info for Shewana3_2825 in Shewanella sp. ANA-3

Annotation: dTDP-4-dehydrorhamnose 3,5-epimerase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 PF04287: DUF446" amino acids 11 to 106 (96 residues), 118 bits, see alignment E=7.7e-39

Best Hits

Swiss-Prot: 44% identical to Y1436_HAEIN: Uncharacterized protein HI_1436 (HI_1436) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K01790, dTDP-4-dehydrorhamnose 3,5-epimerase [EC: 5.1.3.13] (inferred from 100% identity to shn:Shewana3_2825)

Predicted SEED Role

"Hypothetical protein YqcC (clustered with tRNA pseudouridine synthase C)"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.13

Use Curated BLAST to search for 5.1.3.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZ33 at UniProt or InterPro

Protein Sequence (111 amino acids)

>Shewana3_2825 dTDP-4-dehydrorhamnose 3,5-epimerase (RefSeq) (Shewanella sp. ANA-3)
MDLISMLYSQTQTKLAQIAHELQSAGLWSTRAPSDEAMASTAPFACDLMSLAQWLQFIFI
PRMQALIDAGQPLPSKIAIAPMAEHVWSEQAALTPLIGVLNELDMLLNEPR