Protein Info for Shewana3_2820 in Shewanella sp. ANA-3

Annotation: metal dependent phosphohydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 642 PF13185: GAF_2" amino acids 144 to 287 (144 residues), 48.7 bits, see alignment E=2.2e-16 PF01590: GAF" amino acids 145 to 283 (139 residues), 23.2 bits, see alignment E=2.2e-08 PF13487: HD_5" amino acids 321 to 484 (164 residues), 105.2 bits, see alignment E=8.4e-34 PF01966: HD" amino acids 332 to 450 (119 residues), 65.3 bits, see alignment E=1.6e-21 TIGR00277: HDIG domain" amino acids 333 to 421 (89 residues), 28.4 bits, see alignment E=6e-11 PF00571: CBS" amino acids 509 to 551 (43 residues), 20 bits, see alignment 1.8e-07

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2820)

Predicted SEED Role

"Metal-dependent phosphohydrolase, HD subdomain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZ28 at UniProt or InterPro

Protein Sequence (642 amino acids)

>Shewana3_2820 metal dependent phosphohydrolase (RefSeq) (Shewanella sp. ANA-3)
MSMSRSLIIGIKDLPEDLPLSWARLDRQFRVQCMSRAFYERCQRSAAQIINQPICQLFDE
FNAKLCGDILQRTDNYIGLVLRDNQGRRVHFALYVIPEQGWQLILADINYEELPIKGLHS
DYRRAIQASDAWLQHIDDVIQSPQEEVFKVAVAKAIALMDSQYGFILLHNDKSKSLTLAA
RSDYPTPKVNQAEFVEENTQASELESQLWQECVKDYKPIIQNKLESNRSDNLLFDRLLLG
ERYLAVPMIFHNRLVGMVCVVGRDEPYSRNDARSLLTFASILWHSIELPRSLRAVSRQSK
IIKAQKEQLSQSLTQLISAISEALELKDAYTAGHQKSVAQLSYLIGEKLGLEPQRLEGLK
IGALVHDIGKLAIPSQILTKPSKLSKEEYALIQTHPLHGAEIVEDVEFPWPIKQMILQHH
ERLDGSGYPLGLKDKAILYEAKIIAVADVADSILSHRPYRPSLGLAKMTEVLKAGRGTLF
DSEIVDTCLEILINRELSISDHIGSAVLDPVVSVTLDHELADIKRLLTAAHAKVAVVLDE
HHKIIGVITQRLLDYWLSPLIGTAAERDHDRAFLRKKAHQIMEHSVPLISDVATSEDALQ
LLNQMDTEFLVVVNKAQHAIGIIGWRTIAMANKERQEVERLI