Protein Info for Shewana3_2806 in Shewanella sp. ANA-3

Annotation: outer membrane chaperone Skp (OmpH) (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03938: OmpH" amino acids 22 to 161 (140 residues), 105.6 bits, see alignment E=1.3e-34

Best Hits

Swiss-Prot: 38% identical to SKP_PHOLU: Chaperone protein Skp (skp) from Photorhabdus luminescens

KEGG orthology group: K06142, outer membrane protein (inferred from 99% identity to son:SO_1638)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZ14 at UniProt or InterPro

Protein Sequence (165 amino acids)

>Shewana3_2806 outer membrane chaperone Skp (OmpH) (RefSeq) (Shewanella sp. ANA-3)
MVNRALVTLALLGAPLAAQAENIAVVDMGAVFEQLPQREQISQSLKSEFGDRMAEVQKMQ
EEMRSLMEKQQRDGALMNDTQKTELVRKMEALKSEYQLKGKALDEDLRRRQGEEQNKLLV
KVQKAINTIAEKEKYDLVLQRGAVIYVKPNADISGKVVEALSKGK