Protein Info for Shewana3_2803 in Shewanella sp. ANA-3
Annotation: UDP-N-acetylglucosamine acyltransferase (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 58% identical to LPXA_AERHH: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA) from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240)
KEGG orthology group: K00677, UDP-N-acetylglucosamine acyltransferase [EC: 2.3.1.129] (inferred from 100% identity to shm:Shewmr7_2696)MetaCyc: 58% identical to acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase (Vibrio cholerae O1 biovar El Tor str. N16961)
Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase. [EC: 2.3.1.129]
Predicted SEED Role
"Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (EC 2.3.1.129)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.129)
MetaCyc Pathways
- superpathway of (Kdo)2-lipid A biosynthesis (15/17 steps found)
- lipid IVA biosynthesis (P. gingivalis) (9/9 steps found)
- lipid IVA biosynthesis (E. coli) (6/6 steps found)
- lipid IVA biosynthesis (H. pylori) (6/6 steps found)
- lipid IVA biosynthesis (P. putida) (6/6 steps found)
- lipid IVA biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
- lipid IVA biosynthesis (generic) (6/6 steps found)
- superpathway of Kdo2-lipid A biosynthesis (15/25 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.3.1.129
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0KZ11 at UniProt or InterPro
Protein Sequence (256 amino acids)
>Shewana3_2803 UDP-N-acetylglucosamine acyltransferase (RefSeq) (Shewanella sp. ANA-3) MIDTLAFVHPDAKIGKNVTIGPWSYVGAGVEIGDDCWLSSHVVVKGPTIIGKGNRIFQFA SVGEECQDKKYAGEPTRLIIGDNNVIREHVTIHRGTVQDNSETRIGSNNLFMNYVHIAHD CVVGNNVIMANNASIAGHVHVGDWAILGGMTGVHQFVHIGAHAFTAGCSLLLQDVPPFVM AAGQPAIPRGLNSEGMKRRGFSKESQLAVRRAYKTLYRSSLTVDEAIEALAEDAQNDEQV KSFIEFVKSSGRGIIR