Protein Info for Shewana3_2797 in Shewanella sp. ANA-3

Annotation: potassium efflux system protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 648 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 49 (20 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details amino acids 324 to 349 (26 residues), see Phobius details amino acids 355 to 374 (20 residues), see Phobius details TIGR00932: transporter, monovalent cation:proton antiporter-2 (CPA2) family" amino acids 13 to 284 (272 residues), 249.3 bits, see alignment E=2.6e-78 PF00999: Na_H_Exchanger" amino acids 14 to 373 (360 residues), 218.9 bits, see alignment E=1.6e-68 PF02254: TrkA_N" amino acids 407 to 520 (114 residues), 83.8 bits, see alignment E=1.7e-27 PF02080: TrkA_C" amino acids 577 to 645 (69 residues), 39.7 bits, see alignment E=5.8e-14

Best Hits

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 100% identity to shn:Shewana3_2797)

Predicted SEED Role

"Sodium/hydrogen exchanger family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KZ05 at UniProt or InterPro

Protein Sequence (648 amino acids)

>Shewana3_2797 potassium efflux system protein (RefSeq) (Shewanella sp. ANA-3)
MEHGFLIQVLLMLLIAIVAIALLRRIGLPAILAYLLTGVVSGPSGFHWFTQQQMQSVAEL
GVVLLMFTLGLEFSVPRLWAMRRTVFGLGSAQVIVTTVLTMLVALACGLNGIESLVIGAA
IALSSTAIVLKLLNEQGWLRRRHGELSVSVLLFQDLAVVPLLILLPLLGQNDEPLMLATI
TLALLKGILAFFLLMALGKWALPRLFDEVARSRSNELFVLSTLVVALVTGAFTQWLGLSM
ALGAFMAGMLLGESQYRRQLEADIRPFRDLLMGLFFISIGMMLDFALVMQFWWQILLILL
AVVVGKALIVHGLLRLVGEPFRIAISTALSLAQVGEFSFVVLALAVSYGLLSNQLSTMLV
MVAVLSMSIAPWLVRHSVDIAKWLLGIRQSGHVDEVVPIITEDHDLVVILGYGRVGQTIA
RFLKTEAVPYLVLDLDPTRVSEARRAGEPIYFGDVCKRAILKQVGIKHAKMIVITFCETR
SLEEALPLCKQLAPDAKILVRTRDDSELDMLQKAGANQVIPETLEGSLMLVSQVLHQCGV
PLARILKRLESERRNHYQFLHGFFSGTETDFTLESLHAVLLHRGADAVGKQVADIDWELL
RVELRAIRRSGAEVEHPAQDWVFRAGDILLIVGKPRRLEKAEAKLLHG