Protein Info for Shewana3_2762 in Shewanella sp. ANA-3

Annotation: MerR family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 PF13411: MerR_1" amino acids 1 to 66 (66 residues), 67 bits, see alignment E=1.9e-22 PF00376: MerR" amino acids 2 to 38 (37 residues), 51.4 bits, see alignment E=1.2e-17 PF09278: MerR-DNA-bind" amino acids 44 to 107 (64 residues), 67.5 bits, see alignment E=1.9e-22

Best Hits

Swiss-Prot: 40% identical to HMMR_RHILV: HTH-type transcriptional regulator HmrR (hmrR) from Rhizobium leguminosarum bv. viciae

KEGG orthology group: None (inferred from 98% identity to she:Shewmr4_2588)

Predicted SEED Role

"Cu(I)-responsive transcriptional regulator" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KYX0 at UniProt or InterPro

Protein Sequence (129 amino acids)

>Shewana3_2762 MerR family transcriptional regulator (RefSeq) (Shewanella sp. ANA-3)
MKIGEVAKHTGLSVKSIRYYHDIGLVCGERNEAGYRVYRHRDIESLKFVHQCRDLGFSLE
DCKLLLGLRNNDSRNAEDVKQLTRNHLAYVEEQIGKLQNLRSQLQQMVSECQGGEQPHCA
IIDSLNHQH