Protein Info for Shewana3_2720 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 49 to 75 (27 residues), see Phobius details PF04367: DUF502" amino acids 52 to 157 (106 residues), 69.5 bits, see alignment E=1e-23

Best Hits

KEGG orthology group: None (inferred from 99% identity to shm:Shewmr7_2620)

Predicted SEED Role

"FIG01057687: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KYS8 at UniProt or InterPro

Protein Sequence (201 amino acids)

>Shewana3_2720 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MKKTLARGLMNLLPMALSLWLFWSLFVSLDGLGIFILELVGINQHFVGAGFILVVAIVFA
VGLLFSVSPIVWLYGWIERQLMRFPLFKSVYGSIRDIASLMNREGKPNTQQTVLVKQANG
GFVVGFIMTDTPPQPLLDALPEGDWVPVLFQLSYQMAGVTSLVKREDLILVDWSFEEAMR
FNLTAGISQTPGAATVKTKAE