Protein Info for Shewana3_2700 in Shewanella sp. ANA-3

Annotation: tagatose-bisphosphate aldolase noncatalytic subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 PF08013: GatZ_KbaZ-like" amino acids 5 to 418 (414 residues), 577 bits, see alignment E=1e-177

Best Hits

Swiss-Prot: 53% identical to KBAZ_ECO24: D-tagatose-1,6-bisphosphate aldolase subunit KbaZ (kbaZ) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: K00917, tagatose 6-phosphate kinase [EC: 2.7.1.144] (inferred from 100% identity to shn:Shewana3_2700)

MetaCyc: 53% identical to putative tagatose-1,6-bisphosphate aldolase 1 chaperone (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Tagatose-6-phosphate kinase AgaZ (EC 2.7.1.144)" in subsystem N-Acetyl-Galactosamine and Galactosamine Utilization (EC 2.7.1.144)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.144

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KYQ8 at UniProt or InterPro

Protein Sequence (428 amino acids)

>Shewana3_2700 tagatose-bisphosphate aldolase noncatalytic subunit (RefSeq) (Shewanella sp. ANA-3)
MSVIQTIIDANKAGQQAGIFAVCSAQPLVLQAALLQAKANGTPLLIEATANQVNQFGGYT
GMKPQDFIDFVTQMTVELGLNPSQLLFGGDHLGPVVWCQQAAEEAMQLAEDLIAEYVKAG
FTKIHLDTSMACGGDVLPLADELIAARAARLCAVAEAHRAPEQALCYVIGTEVPAPGGVS
EMEAELAVTPVSAIEHTLNCHRDAFAAAGLGEEVWQKVIAVVVQPGVEFDNSQVHLFEPE
ATHAQSEFIRGYPRLVFEAHSTDYQLSMGYQALVQQHFAILKVGPQLTFALREALFALSH
IENVLCQPEQCSDLRQSCFELMRDNPKYWQGFYADNEALKWQLGFSFSDRVRYYWPSLQN
KVEQLLSNLAQSIPLPLISQYLPNQYTAVLAGELKPTARELVLHKITEVLADYANACQLP
VMQSPLKG