Protein Info for Shewana3_2697 in Shewanella sp. ANA-3

Annotation: N-acetylglucosamine 6-phosphate deacetylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 TIGR00221: N-acetylglucosamine-6-phosphate deacetylase" amino acids 9 to 381 (373 residues), 264.7 bits, see alignment E=6.3e-83 PF01979: Amidohydro_1" amino acids 59 to 384 (326 residues), 74.9 bits, see alignment E=3.7e-25

Best Hits

Swiss-Prot: 100% identical to AGAA2_SHESA: N-acetylgalactosamine-6-phosphate deacetylase (agaAII) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K01443, N-acetylglucosamine-6-phosphate deacetylase [EC: 3.5.1.25] (inferred from 100% identity to shn:Shewana3_2697)

MetaCyc: 100% identical to N-acetylgalactosamine-6-phosphate deacetylase (Shewanella sp. ANA-3)
N-acetylglucosamine-6-phosphate deacetylase. [EC: 3.5.1.25]

Predicted SEED Role

"N-acetylgalactosamine-6-phosphate deacetylase, predicted alternative (EC 3.5.1.25)" in subsystem N-Acetyl-Galactosamine and Galactosamine Utilization (EC 3.5.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.25

Use Curated BLAST to search for 3.5.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KYQ5 at UniProt or InterPro

Protein Sequence (394 amino acids)

>Shewana3_2697 N-acetylglucosamine 6-phosphate deacetylase (RefSeq) (Shewanella sp. ANA-3)
MKPNTDFMLIADGAKVLTQGNLTEHCAIEVSDGIICGLKSTISAEWTADKPHYRLTSGTL
VAGFIDTQVNGGGGLMFNHVPTLETLRLMMQAHRQFGTTAMLPTVITDDIEVMQAAADAV
AEAIDCQVPGIIGIHFEGPHLSVAKRGCHPPAHLRGITEREWLLYLRQDLGVRLITLAPE
SVTPEQIKRLVASGAIISLGHSNADGETVLKAIEAGASGFTHLYNGMSALTSREPGMVGA
AFASENTYCGIILDGQHVHPISALAAWRAKGTEHLMLVTDAMSPLGSDQTEFQFFDGKVV
REGMTLRDQHGSLAGSVLDMASAVRYAATELNLGLSNAVQMATRTPAEFIQRPQLGDIAE
GKQADWVWLDDDQRVLAVWIAGELLYQAEQARFA