Protein Info for Shewana3_2691 in Shewanella sp. ANA-3

Annotation: DNA-O6-methylguanine--protein-cysteine S-methyltransferase / transcriptional regulator Ada (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 PF00165: HTH_AraC" amino acids 15 to 56 (42 residues), 36.4 bits, see alignment 8.6e-13 PF12833: HTH_18" amino acids 28 to 107 (80 residues), 65.8 bits, see alignment E=6.9e-22 TIGR00589: methylated-DNA--[protein]-cysteine S-methyltransferase" amino acids 213 to 292 (80 residues), 107.2 bits, see alignment E=1.7e-35 PF01035: DNA_binding_1" amino acids 214 to 293 (80 residues), 109.7 bits, see alignment E=1.1e-35

Best Hits

KEGG orthology group: K10778, AraC family transcriptional regulator, regulatory protein of adaptative response / methylated-DNA-[protein]-cysteine methyltransferase [EC: 2.1.1.63] (inferred from 100% identity to shn:Shewana3_2691)

Predicted SEED Role

"ADA regulatory protein / Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63)" in subsystem DNA repair, bacterial (EC 2.1.1.63)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.63

Use Curated BLAST to search for 2.1.1.63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KYP9 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Shewana3_2691 DNA-O6-methylguanine--protein-cysteine S-methyltransferase / transcriptional regulator Ada (RefSeq) (Shewanella sp. ANA-3)
MTQDYERIARAIDFIRQHVGHQPSLAEIAAHVHLSEYHFQRLFSRWAGITPKRYLQALTL
ERAKQLLQQPSHSTLSASYELGLSSGSRLYDHFVQLEAVTPFEYRQQGLGISIAYGYHST
PFGLAFIAQTARGICQFDFVDMQQIPSPLERLKQSWSQATIYEDTAQTASLIDHLFSQYF
AGSSAAALNLTAPNTQAIQQGEPAPLSLWVKGTNFQLNVWRALLNLPKGEVASYGDIAKA
IGKPKASRAVGTAIGANPVALLIPCHRVLRQSGELGGYRWGETRKHAILAREAAYCE