Protein Info for Shewana3_2684 in Shewanella sp. ANA-3

Annotation: gluconate transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 43 (17 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 264 to 289 (26 residues), see Phobius details amino acids 305 to 326 (22 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 364 to 384 (21 residues), see Phobius details amino acids 390 to 413 (24 residues), see Phobius details amino acids 431 to 451 (21 residues), see Phobius details PF02447: GntP_permease" amino acids 1 to 450 (450 residues), 316 bits, see alignment E=1.9e-98

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2684)

Predicted SEED Role

"D-glycerate transporter (predicted)" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KYP2 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Shewana3_2684 gluconate transporter (RefSeq) (Shewanella sp. ANA-3)
MNLVLILIGVIAFIVIATSKFKLHPFLTLILAAFIAAFAYGLPSGDIAKTITTGFGNILG
YIGLVIVLGTIIGIILEKSGAAITMADVVIKVLGKRFPTLTMSIIGYLVSIPVFCDSGFV
ILNSLKQSMANRMKVSSVSMSVALATGLYATHTFVPPTPGPIAAAGNLGLESNLGLVIGV
GLLVAAVAALAGMFWANRFASVEPDGEGAEELKAQAADFEALKQSYGTLPSPLKAFAPIF
VPILLICLGSIANFPSAPLGKEGLFSLLVFLGQPVNALLIGLFLSLLLLKSDNKIAEFSE
RISQGLVAAAPIILITGAGGAFGAVLKATPIGDFLGSSLSALGVGIFMPFIVAAALKSAQ
GSSTVALVATSALVAPMLGDIGLGSDMGRVLTVMAIGAGAMTVSHANDSFFWVVTQFSRM
SVKQAYKAQTMATLIQGVTAMLTVYVLSLVLL