Protein Info for Shewana3_2677 in Shewanella sp. ANA-3

Annotation: cytochrome C family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF13435: Cytochrome_C554" amino acids 27 to 101 (75 residues), 22.6 bits, see alignment E=6.2e-08 TIGR03508: decaheme c-type cytochrome, DmsE family" amino acids 59 to 323 (265 residues), 341.5 bits, see alignment E=3.1e-106 PF22678: Cytochrom_c_NrfB-like" amino acids 96 to 171 (76 residues), 52 bits, see alignment E=2.9e-17 PF14537: Cytochrom_c3_2" amino acids 148 to 233 (86 residues), 27.3 bits, see alignment E=1.5e-09 PF09699: Paired_CXXCH_1" amino acids 149 to 187 (39 residues), 24 bits, see alignment 8.9e-09 amino acids 202 to 237 (36 residues), 39.9 bits, see alignment 9.4e-14 amino acids 244 to 281 (38 residues), 50.2 bits, see alignment 5.8e-17 TIGR01905: doubled CXXCH domain" amino acids 202 to 236 (35 residues), 29.3 bits, see alignment 6.2e-11 amino acids 244 to 281 (38 residues), 41.8 bits, see alignment 7.9e-15

Best Hits

Swiss-Prot: 93% identical to MTRA_SHEB8: Multiheme cytochrome MtrA (mtrA) from Shewanella baltica (strain OS185)

KEGG orthology group: None (inferred from 99% identity to shm:Shewmr7_2579)

Predicted SEED Role

"periplasmic decaheme cytochrome c, MtrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KYN5 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Shewana3_2677 cytochrome C family protein (RefSeq) (Shewanella sp. ANA-3)
MKNSHKMKNLLPALMMSAVMAFAIAPSAHASKWDEKMTPEQVEATLDKKFAEGNYSPKGA
DSCLMCHKKSEKVMDLFKGVHGAIDSTKSPMAGLQCEACHGPMGQHNKGGNEPMITFGKQ
STLSADKQNSVCMSCHQDDKRMSWNGGHHDNADVACASCHQVHVAKDPVLSKNTEMDVCT
SCHTKQKADMNKRSSHPLKWAQMTCSDCHNPHGSMTDSDLNKPSINETCYSCHAEKRGPK
LWEHAPVTESCVTCHNPHGSVNDAMLKTRAPQLCQQCHASDGHASNAYLGNTGLGSNVGD
NAFTGGRSCLNCHSQVHGSNHPSGKLLQR