Protein Info for Shewana3_2672 in Shewanella sp. ANA-3

Annotation: cytochrome C family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF13435: Cytochrome_C554" amino acids 53 to 100 (48 residues), 17.7 bits, see alignment 1.5e-06 TIGR03508: decaheme c-type cytochrome, DmsE family" amino acids 58 to 315 (258 residues), 323.4 bits, see alignment E=1.1e-100 PF09699: Paired_CXXCH_1" amino acids 150 to 186 (37 residues), 21 bits, see alignment 5.3e-08 amino acids 196 to 236 (41 residues), 41.7 bits, see alignment 1.9e-14 amino acids 243 to 280 (38 residues), 46 bits, see alignment 8.6e-16 TIGR01905: doubled CXXCH domain" amino acids 203 to 235 (33 residues), 30.4 bits, see alignment 2.9e-11 amino acids 243 to 280 (38 residues), 38.5 bits, see alignment 8.1e-14

Best Hits

Swiss-Prot: 69% identical to MTRA_SHEB8: Multiheme cytochrome MtrA (mtrA) from Shewanella baltica (strain OS185)

KEGG orthology group: None (inferred from 99% identity to she:Shewmr4_2506)

Predicted SEED Role

"periplasmic decaheme cytochrome c, MtrD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KYN0 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Shewana3_2672 cytochrome C family protein (RefSeq) (Shewanella sp. ANA-3)
MNMDIGLKFKSITQVMLAVMLSILSLSTLATPWDDKPPEEVVATLDKKFAEGKYSAKGAD
TCLMCHKKSATVMAIFDGVHGNPNIKDSPMADLQCEACHGPLGNHNKGGKEPMITFGQNS
PVPAQKQNSVCMSCHNDDQRIAWKGNHHDNADIPCSSCHQVHVAKDPISDKANEVAICTQ
CHTQQKADMHKRSSHPLQWQQMVCSDCHNPHGSLNDASLKQMSVNENCYSCHAEKRGPKL
WEHAPVTDNCANCHNPHGSVNESMLISKPPQLCQQCHASDGHSSNAYFGNQTNAFTSGNS
CMNCHGQVHGSNHPSGKLLQR