Protein Info for Shewana3_2648 in Shewanella sp. ANA-3

Annotation: phage shock protein A, PspA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 TIGR02977: phage shock protein A" amino acids 1 to 218 (218 residues), 318.1 bits, see alignment E=1.6e-99 PF04012: PspA_IM30" amino acids 2 to 216 (215 residues), 153.2 bits, see alignment E=4.3e-49

Best Hits

Swiss-Prot: 56% identical to PSPA_ECOLI: Phage shock protein A (pspA) from Escherichia coli (strain K12)

KEGG orthology group: K03969, phage shock protein A (inferred from 100% identity to shn:Shewana3_2648)

Predicted SEED Role

"Phage shock protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KYK6 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Shewana3_2648 phage shock protein A, PspA (RefSeq) (Shewanella sp. ANA-3)
MGIFSRFADIINSNISALLDKAEDPEKMVRLIIQEMEDTLVEVRSTSAKVLAEKKELIRR
ISRVEEQVQDWQDKAELALSKDREDLAKAALVEKQKAAGLVDTLNQELAVIDEHIVRLKD
EVSLLQEKLLDAKARQKTIILRKQTASSRLEVKKQLDSSKIDNAMLKFEQYERRVEGLEA
QVESYDLGNKKTLADEFAALEAEDSVNAELEALKAKVKGKAATKSKE