Protein Info for Shewana3_2643 in Shewanella sp. ANA-3

Annotation: methionine gamma-lyase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01328: methionine gamma-lyase
  • amino acids 10 to 395 (386 residues), 558.7 bits, E=3.3e-172
• PF01053: Cys_Met_Meta_PP
  • amino acids 12 to 393 (382 residues), 498.5 bits, E=2.4e-153
• PF00155: Aminotran_1_2
  • amino acids 64 to 202 (139 residues), 30.3 bits, E=6.6e-11
• PF01041: DegT_DnrJ_EryC1
  • amino acids 65 to 186 (122 residues), 34.2 bits, E=4.4e-12
• PF00266: Aminotran_5
  • amino acids 86 to 234 (149 residues), 24.6 bits, E=3e-09

Best Hits

Swiss-Prot: 54% identical to MEGL_FUSNP: L-methionine gamma-lyase (mgl) from Fusobacterium nucleatum subsp. polymorphum

KEGG orthology group: K01761, methionine-gamma-lyase [EC: 4.4.1.11] (inferred from 100% identity to shn:Shewana3_2643)

MetaCyc: 51% identical to MdeA (Pseudomonas putida)
Methionine gamma-lyase. [EC: 4.4.1.11]

Predicted SEED Role

"Methionine gamma-lyase (EC 4.4.1.11)" in subsystem Methionine Degradation (EC 4.4.1.11)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-threonine degradation I (6/6 steps found)
• L-methionine degradation II (3/3 steps found)
• seleno-amino acid detoxification and volatilization III (2/3 steps found)
• dimethyl sulfide biosynthesis from methionine (1/2 steps found)
• seleno-amino acid detoxification and volatilization I (1/2 steps found)
• superpathway of seleno-compound metabolism (8/19 steps found)
• hypoglycin biosynthesis (4/14 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.11

Sequence Analysis Tools

See A0KYK1 at UniProt or InterPro

Protein Sequence (397 amino acids)

>Shewana3_2643 methionine gamma-lyase (RefSeq) (Shewanella sp. ANA-3)
MQDESSKQWKAATQAIHAGHEREAFGTLVTPLYQTATFVFESAQQGGERFAGNEPGYIYT
RLGNPTVAELERKMAILEGAEAAAATASGMGAVSAALLANLQMGDHLVASNAVYGCTFAL
MTSQFARFGIEVTLVDFTDLAAIERAIKPNTRVIFCETPVNPHLQVFDLKGIADIAKRHQ
LVSIVDNTFMTPLLQQPLAFGIDLVVHSATKYLNGHGDVIAGVVCGSEEQLHRVKYEILK
DIGAVMSPHDAWLILRGLKTLDVRLQRHCDSAQRVAEFLEQHPAVTRVYYPGLKSHSGHR
FIGGQMAKAGGVIAFELAASLEQAMAFVGYLKLFSIAVSLGDAESLIQHPASMTHSPYTP
EARQAAGISDNLLRISIGLEDCGDIIEDLNQALAMLA