Protein Info for Shewana3_2606 in Shewanella sp. ANA-3

Annotation: DEAD/DEAH box helicase domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 PF00270: DEAD" amino acids 25 to 196 (172 residues), 164.3 bits, see alignment E=3.3e-52 PF04851: ResIII" amino acids 39 to 190 (152 residues), 37.5 bits, see alignment E=3.6e-13 PF00271: Helicase_C" amino acids 233 to 341 (109 residues), 103.6 bits, see alignment E=1.1e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2606)

Predicted SEED Role

"ATP-dependent RNA helicase VCA0061" in subsystem ATP-dependent RNA helicases, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KYG4 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Shewana3_2606 DEAD/DEAH box helicase domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MQFTDFSLDQRLLQSLKHMGIATPTAIQEQALPIALAGKDLMASSKTGSGKTLAFLLPAM
QRVISTRALTKRDPRVLILLPTRELAHQVYSQLRLLVANTQYKAISVLGGENFNDQAKAL
AKEPHFIVATPGRIADHLEQKNLFLNGLELLVLDEADRMLDLGFAPQLKAINAAADHKRR
QTLMFSATLDHSEINEIAAALLKNPSHVAIGAAHTEHQDITQRIYLCDHLDHKEALLTRL
LSDETHKQVIIFTATRADTERLASKLSAQGFATAALSGELKQAARNQIMDQFARGQQQIL
VTTDVASRGLDLLNVSLVINFDMPKFAEEYVHRIGRTGRAGAKGDAISLVGPKDWDNFKK
VQLFLRKTFEISVIQGLEAKFSGLKDKPKTAATKAVTKAGTKTKAKTKSKTVKTAASRDK
RFITGVDVGDAPMRKKPAAPLLQDHDDER