Protein Info for Shewana3_2602 in Shewanella sp. ANA-3

Name: nrdG
Annotation: anaerobic ribonucleotide reductase-activating protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 TIGR02491: anaerobic ribonucleoside-triphosphate reductase activating protein" amino acids 2 to 150 (149 residues), 205.6 bits, see alignment E=2e-65 PF13353: Fer4_12" amino acids 12 to 150 (139 residues), 187.9 bits, see alignment E=5.5e-60

Best Hits

Swiss-Prot: 73% identical to NRDG_VIBCH: Anaerobic ribonucleoside-triphosphate reductase-activating protein (nrdG) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K04068, anaerobic ribonucleoside-triphosphate reductase activating protein [EC: 1.97.1.4] (inferred from 100% identity to shn:Shewana3_2602)

MetaCyc: 66% identical to anaerobic ribonucleoside-triphosphate reductase activating protein (Escherichia coli K-12 substr. MG1655)
1.97.1.-

Predicted SEED Role

"Ribonucleotide reductase of class III (anaerobic), activating protein (EC 1.97.1.4)" in subsystem Ribonucleotide reduction (EC 1.97.1.4)

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KYG0 at UniProt or InterPro

Protein Sequence (153 amino acids)

>Shewana3_2602 anaerobic ribonucleotide reductase-activating protein (RefSeq) (Shewanella sp. ANA-3)
MNYHQYYPVDVVNGPGTRVTLFVSGCEHQCRGCYNQSTWDVRSGHLFDKAMEDTLIADLQ
DERIVRRGLSLSGGDPLLPANLEGMLALVKRVKTECPGKDIWLWTGYTWDALTDKQRAVL
EYVDVLVDGKFEQSLADPSLPYRGSSNQVIRFL