Protein Info for Shewana3_2587 in Shewanella sp. ANA-3

Annotation: NnrS family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 63 to 80 (18 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 116 to 139 (24 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details amino acids 239 to 256 (18 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details amino acids 353 to 355 (3 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details PF05940: NnrS" amino acids 15 to 384 (370 residues), 365.6 bits, see alignment E=1.8e-113

Best Hits

KEGG orthology group: K07234, uncharacterized protein involved in response to NO (inferred from 100% identity to shn:Shewana3_2587)

Predicted SEED Role

"NnrS protein involved in response to NO" in subsystem Denitrification or Nitrosative stress or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KYE5 at UniProt or InterPro

Protein Sequence (390 amino acids)

>Shewana3_2587 NnrS family protein (RefSeq) (Shewanella sp. ANA-3)
MLNIDEPAHLQPKVALFRLGFRPFFLFASLFSLLSLGIWGGLLSGKSLLPSTLNPLWWHG
HEMIFGFVCAVVAGFLLTAVQNWTGRPGIKGLPLAGLFLVWLLPRLLLILPFNIPLVAIM
VIDLLFLPLTAVLLAISVIEVRQWRNFVFIPILSLLTIFNGVSYYGLMTNQLNWMNNGLY
AAVILVAVIVALLGGRVIPFFTERATQWQKQSPIPAIEYLSFVSLLALVISLFLTETLLT
RILAGVAGLVLFIRWFRWGWNASWPVPLLWSLHLSYLCIPIGLGLIAAGLPLSVGMHSIT
VGGLGGMILAMMSRVSLGHTGRTLTPPRPMALAFALILIATVLRVLAGLLSTWFIELMLA
AIALWIFAFGCFCYCYGPMLCRVRADGRPG